Enjoy 30% off select life science products  with free shipping and giveaways with promo code: RESEARCH30 Offer ends October 2, 2020.

Cart
 
Inquire

Anti-ARID1A mouse monoclonal antibody (M02), Clone 3H14, 100 µg

Anti-ARID1A mouse monoclonal antibody (M02), Clone 3H14, 100 µg

$479.10
ARID1A monoclonal antibody (M02), clone 3H14

Product Description: Mouse monoclonal antibody raised against a partial recombinant

SKU: 08A0082891

Packaging size:
100 µg
Request a quote
Product Description
ARID1A monoclonal antibody (M02), clone 3H14

Product Description: Mouse monoclonal antibody raised against a partial recombinant ARID1A.

Immunogen: ARID1A (NP_006006, 1216 a.a. ~ 1326 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.

Immunogen Sequence (without GST): NTSDMMGRMSYEPNKDPYGSMRKAPGSDPFMSSGQGPNGGMGDPYSRAAG PGLGNVAMGPRQHYPYGGPYDRVRTEPGIGPEGNMSTGAPQPNLMPSNPD SGMYSPSRYP*

Reactivity: Human

Isotype: IgG Mix Kappa

Storage Buffer: In 1x PBS, pH 7.2

Storage Instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.

Quality Control Testing: Antibody Reactive Against Recombinant Protein.
Specifications
SKU 08A0082891
Antibody Type Monoclonal Antibody
Base Catalog Number A0082891
Clone Name 3H14
Conjugate Unconjugated
Formulation Details Purified
Host Mouse
Isotype IgG2a, kappa
Pack Size 100 µg
Purity Affinity Purified
Solubility Soluble in water
Documents

Certificates of Analysis

Certificates of Analysis
English (United States)
Certificates of Analysis
English (United States)
Certificates of Analysis
English (United States)

Material Safety Data Sheet

Material Safety Data Sheet
English (United States)